HORDB

ID: hor005237
Uniprot ID: P10034
Protein name: Big gastrin
Gene name: GAST
Organism: Chinchilla chinchilla (Short-tailed chinchilla) (Chinchilla brevicaudata)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Chinchilla (genus), Chinchillidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: ELEPQGPPHLGTDLSKKQGPWAEEEAAYGWMDF
Length: 33(1-33)
Propeptide: ELEPQGPPHLGTDLSKKQGPWAEEEAAYGWMDF
Signal peptide: NA
Modification: T18 Pyrrolidone carboxylic acid;T28 Sulfotyrosine;T33 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-P10034-F1.pdb

hor005237_AF2.pdb

hor005237_ESM.pdb

Mass:	428603	Formula:	C168H241N41O53S
Absent amino acids:	CINRV	Common amino acids:	E
pI:	3.99	Basic residues:	3
Polar residues:	7	Hydrophobic residues:	9
Hydrophobicity:	-101.82	Boman Index:	-5050
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	44.55
Instability Index:	5219.7	Extinction Coefficient cystines:	12490
Absorbance 280nm:	390.31